SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479150110|ref|YP_007780286.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150110|ref|YP_007780286.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.96e-24
Family PadR-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150110|ref|YP_007780286.1|
Sequence length 175
Comment transcriptional regulator, PadR family [Ruminococcus bromii L2-63]
Sequence
MATIDLIVLGMLKKEALSAYDIQKLVEYRNISKWVKISTPSIYKKVIQLEEKGYISSNIV
KEGKMPEKAIYSLTEAGEKQLENLMFEISAKPIQIFLDFNAVIVNLDALLPENQMKCLTD
IEANIKTLKSYLEKNLKAKENVPEIPQTGLAVLQQQFILAQSIETWIDELKLKYE
Download sequence
Identical sequences A0A1Q6MXM8 D4L4G4
gi|479150110|ref|YP_007780286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]