SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479150989|ref|YP_007781165.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150989|ref|YP_007781165.1|
Domain Number 1 Region: 10-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.69e-27
Family ArsR-like transcriptional regulators 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150989|ref|YP_007781165.1|
Sequence length 105
Comment transcriptional regulator, ArsR family [Ruminococcus bromii L2-63]
Sequence
MENKEKTTTPEMPDIDVLFELADLFKVFGDSTRLRIMYTISENEMSVLNIAEALSMEQST
ISHQLRVLRQNKLVRVRREGKQIYYSLDDDHVKRIIEMGLDHVLE
Download sequence
Identical sequences A0A1C6EAS6 D4L6Z3 R5DUZ2
gi|479150989|ref|YP_007781165.1| 2004040887 2004015310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]