SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479151256|ref|YP_007781432.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151256|ref|YP_007781432.1|
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.67e-34
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479151256|ref|YP_007781432.1|
Sequence length 135
Comment transcriptional regulator, BadM/Rrf2 family [Ruminococcus bromii L2-63]
Sequence
MLISSKGRYTLYVLVDLAKNGQNRYIPLKEIAERQNISKKYMEGILKTLVDRNLLEGVKG
KGGGYKLTKEPKDYSLGEILRLTEGDLASVPCTSKTHEHCNHMESCPSHPIWQQLDNLIN
NYLDSVTLANLLNNE
Download sequence
Identical sequences D4L7R0
2004010893 2004035788 gi|479151256|ref|YP_007781432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]