SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479151863|ref|YP_007782039.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479151863|ref|YP_007782039.1|
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-25
Family FUR-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479151863|ref|YP_007782039.1|
Sequence length 130
Comment Fe2+/Zn2+ uptake regulation proteins [Ruminococcus bromii L2-63]
Sequence
MAKRNFSSKRNAIYNAVCGTDTHPSARWVYDKLKPEIPDLSLGTVYRNIALFKDEGKVSV
ICNVNGEERIDGNTEPHPHFVCNKCNAVIDVEDNQNADDLESQLAEEGFKVENRFVIYYG
ICPKCSAEVH
Download sequence
Identical sequences A0A1C6HZ85 A0A1Q6TH53 D4L9G7
gi|479151863|ref|YP_007782039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]