SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379729001|ref|YP_005321197.1| from Saprospira grandis str. Lewin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379729001|ref|YP_005321197.1|
Domain Number 1 Region: 201-594
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.94e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.00081
Further Details:      
 
Domain Number 2 Region: 60-246
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.7e-19
Family Penicillin binding protein dimerisation domain 0.0071
Further Details:      
 
Domain Number 3 Region: 664-716
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379729001|ref|YP_005321197.1|
Sequence length 719
Comment peptidoglycan glycosyltransferase [Saprospira grandis str. Lewin]
Sequence
MKITKLTPKQDVLWRIYLTFALMGFIGILIMGRIASIQYFEGSQLREKAEQEHIALKDVK
APRGNILADDGSLLATSLPYFKVHWDTKVVPRDTFDKYVDTLATCLATYVYTDKTPGLCR
QELINARDSSRRYHPILPNVSYILLQKIKEFPIFSMGDRLKSGLIVEQMAKRQYPFKMLA
HRTIGYSRVVQTANGPDTLSVGLERSFDNVLAGEQGKQYMQRLSKDLWVPVDDISKIEPR
AGQDIVTTIDVNIQDVTERALLESLQQYEGEHGCAIVMDVKTGAIKAIANIGFNKERTEF
WENYNYAVGERTEPGSTFKLASIMALMEDGYVKPTDTVNLEEGRHTFYNETMEDASYHGL
RLTTVGKAFEISSNVGIAKLTHKYYNKSKEGQSQFIQRLSDMVLTQSTNVDIDGEREPYI
KDPNNSDWSGITIPWMSIGYESELTPLQMLTFYSAVANGGQMMKPQIVTEIRSYGSVVKK
IPPKVVKRRIASEATIQAATDMLKRVVASPKGTAHSIYTPRYAIAGKTGTAIMNYKAHKQ
KGEAKRYRGSFAGFFPADNPAYACVVVITNPRTGFYGGRVAAPVFRKIADYCYSLSLGSH
KALNADEAVYTDATLPRLPVGQKEDLNYIMKELNLPFADSSATPWAVGMIRNDSINLRSR
NVQKDVVPNVVGMGLKDALFLLENNRLRVRVLGVGKVKSQSVPAGRSIQSVQTITLVLG
Download sequence
Identical sequences H6L2F5
gi|379729001|ref|YP_005321197.1| WP_015691264.1.67438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]