SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379730556|ref|YP_005322752.1| from Saprospira grandis str. Lewin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379730556|ref|YP_005322752.1|
Domain Number 1 Region: 197-396
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 3.92e-34
Family Peptidoglycan hydrolase LytM 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|379730556|ref|YP_005322752.1|
Domain Number - Region: 31-151
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0837
Family Formin homology 2 domain (FH2 domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379730556|ref|YP_005322752.1|
Sequence length 398
Comment M23 family peptidase [Saprospira grandis str. Lewin]
Sequence
MAISSSICLLICLWTLPLLGQSRAELLAKRKRLSQQIAQTASLLDQTASNKSQTVEELAS
LQKQLEQRQELLEVLEKEQAQLAAETKEREGKLAELQGQLSAFKASYKKVLVELYKTKKT
SSYWGNWLSFSGWSRSYRQSIYLKELEEKRRRQALLLQKTADKEAEELAQLEKKRIEQEQ
LLIATKEQQLQLEEELSDKDQLLKSLKRKEGSLRQALKAKERQKKQLNRNIEAAIQAQML
AAKKKARVYEDGGSSNSYKTSSNQQFKSKKGKLPAPVNGSIIAAFGRRRHPLFEEVYLEN
NGVDYRTAAKASVRSIADGRVVSLFEIPGSGKAILVQHANYYSSYAHIQNAKVKAGQKVS
AGQQLAEVSKDPQSGTYILHFELWEGKKKLNPQQWLRP
Download sequence
Identical sequences H6L5F2
gi|379730556|ref|YP_005322752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]