SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379731332|ref|YP_005323528.1| from Saprospira grandis str. Lewin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379731332|ref|YP_005323528.1|
Domain Number 1 Region: 451-523
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000106
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 
Weak hits

Sequence:  gi|379731332|ref|YP_005323528.1|
Domain Number - Region: 179-296
Classification Level Classification E-value
Superfamily L-A virus major coat protein 0.0942
Family L-A virus major coat protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379731332|ref|YP_005323528.1|
Sequence length 749
Comment sulfate transporter family protein [Saprospira grandis str. Lewin]
Sequence
MIGQKFRQEWRSNWLQAKPSWQEDGVAAFSMAMVTIPLCLGIALASGVPPMAGLFSAIMG
GLIATLFRSSQLTMNGPAASLIVVTLSCIELLGDGNALAGFRYFLAATVVAGVFLMLFGL
LRLGRYGDIFSRSVIYGVLGAIGLIILGKQMPVALGAESWALTPMESLEEIPELFLRQNP
IVGLITLGSVALLVLQAYTKNRWIQMIPGPVWVIGFSMIMAYLLNLDEPHTVEAMGQSFA
LGPDLLVNLPEDIWENVVYPDFSKWDHFYFWQIVVTITLIVSIETVISAKAMDKIDPLGR
QTNLNKDLFACGLSSIFSACVGGLPVITAVPMYYGAKTKWANLFQALMLVVFVLFLPVFA
RGVPLAALATLLIFTAYKLASPKIFKDTFRLGLEQFVVLISTLLMILFNGLLWGIAFGFA
VTIFLQYSQSNLEFKQFWRYLLRPDIQVEERADGQIYVAIKGVINFINILQLKNTLRSAN
KKDLLILDLSNTRLVDSAVLEYLNEEVERYDLPNLNFDIIGLDAHETSSRHPNAMHVLPE
NKKPQLTKRQQALGELAEAKSGQFWPELSWEVNMLKQFSFFQTRPIEYKLNMAKGNYQLF
FEWESCDLTFAQGALFNAQAYHSSIILLHLPFNAPLFVLEAEKGPTKIGAQLSVYKDVNF
RSHPQFSHRYLLRGPSEKDMREFFDTDLLDFLESQPTHYIESNGTMIFIMHQLRFASLQE
MREMHNFAEELSKKLMLSWRKQTQAQLKS
Download sequence
Identical sequences H6L0Y8
gi|379731332|ref|YP_005323528.1| WP_015693540.1.67438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]