SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407456326|ref|YP_006734899.1| from Chlamydia psittaci VS225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407456326|ref|YP_006734899.1|
Domain Number 1 Region: 162-201,235-317
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000443
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407456326|ref|YP_006734899.1|
Sequence length 335
Comment hypothetical protein B600_0164 [Chlamydia psittaci VS225]
Sequence
MKLNNALPTLEALCKKTHQKLRQYLIRHSLLLFGCLLLMGVELGVFLYFFLFSGKTIVPA
FCLACFFLTLFVCLVVRLYILSGKPDFFENLATDYLRNAQTLFKGKHNIVEEQTHLASSA
TKLAIDLQNQEYTLLSSVLSFLPKHDFMRKFSCFCFWKDYFLFRECLLQKSIEAYIKVVQ
SIPVDLGAHVSLADAYVALSGLYADPRKYPEFDVSYWVPPGRYGEDVQEKFFATAQRAIE
EFKILNEYAPGNAWVHTQLAYSYHDLQMPLEEIQEYEMILKLKPADVETMTKLGILYFQQ
GMNAKGLRIYEELKKRDYKKSRKLIKFYGIEYNSY
Download sequence
Identical sequences A0A0E2IX91 A0A0E2J1E6 A0A2D2D890 S4M8Q6 S7IK64 S7IWK6
gi|406594802|ref|YP_006741290.1| gi|406591957|ref|YP_006739137.1| gi|384452220|ref|YP_005664817.1| gi|410858125|ref|YP_006974065.1| gi|407458938|ref|YP_006737041.1| gi|392376350|ref|YP_004064128.1| gi|449070783|ref|YP_007437863.1| gi|407457692|ref|YP_006735997.1| gi|384454172|ref|YP_005666767.1| gi|407454960|ref|YP_006733851.1| gi|406593067|ref|YP_006740246.1| gi|407460310|ref|YP_006738085.1| gi|407456326|ref|YP_006734899.1| gi|332287097|ref|YP_004421998.1| gi|384451244|ref|YP_005663842.1| WP_006342814.1.1164 WP_006342814.1.11713 WP_006342814.1.12211 WP_006342814.1.13912 WP_006342814.1.16297 WP_006342814.1.17627 WP_006342814.1.18414 WP_006342814.1.1931 WP_006342814.1.19843 WP_006342814.1.21207 WP_006342814.1.21855 WP_006342814.1.24561 WP_006342814.1.28684 WP_006342814.1.28891 WP_006342814.1.31403 WP_006342814.1.33036 WP_006342814.1.33221 WP_006342814.1.34025 WP_006342814.1.34320 WP_006342814.1.37886 WP_006342814.1.37937 WP_006342814.1.38386 WP_006342814.1.39749 WP_006342814.1.40572 WP_006342814.1.46040 WP_006342814.1.46511 WP_006342814.1.46631 WP_006342814.1.47737 WP_006342814.1.5305 WP_006342814.1.53856 WP_006342814.1.57788 WP_006342814.1.62003 WP_006342814.1.64751 WP_006342814.1.66441 WP_006342814.1.69777 WP_006342814.1.75063 WP_006342814.1.76581 WP_006342814.1.77046 WP_006342814.1.77465 WP_006342814.1.81755 WP_006342814.1.83304 WP_006342814.1.8387 WP_006342814.1.84280 WP_006342814.1.84771 WP_006342814.1.87193 WP_006342814.1.87516 WP_006342814.1.91541 WP_006342814.1.91940 WP_006342814.1.9241 WP_006342814.1.97314 WP_006342814.1.99633 gi|384453194|ref|YP_005665790.1| gi|332287097|ref|YP_004421998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]