SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407456859|ref|YP_006735432.1| from Chlamydia psittaci VS225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407456859|ref|YP_006735432.1|
Domain Number 1 Region: 297-332,367-466
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000496
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407456859|ref|YP_006735432.1|
Sequence length 501
Comment hypothetical protein B600_0716 [Chlamydia psittaci VS225]
Sequence
MMPRSLFAVFVFVIAIEGFGSKIFCEGTTIPQDQYEDFWNLDPYCLESLCAYFVIHGDHQ
SRKKLEKFFPQLTVNELKTLSNCVLLSKNPDYVFSKEDVEVMKKLNLQGISFLCHNDDAS
FLPEKDLARALVYAEFPGEEGKSKAEHYTQYLDILALRAYIERQRHLDGEHSPVGSEAYH
RATIEALNTILFYEEGIRYPSKNEMFSDEFSFLSSVADRKFGVCLGVSSLYLSLAQRLDL
PLESVTPPGHIYLRYGGGKVNIETTAGGRHLPTEHYCDCLNVDELRIRSEKELIGLTFIN
QGSFALQKQQYHEADLAYEKAKEYVDDHELEELLGIVKILKGQRKEGEALLKSSSQAQTL
GSVAHDYLQGHIDEATLKLLFTHPGSTYEEVLSYQEALKKAVQRSPKCCESRRRLASVFL
HLGKIAEGVALLEQSAKEAPEDIALHLKLSKVFCDRHDYAKAQKYFLIAEGLLKDRGIQD
EDKKSFTLYHEIRKKMFSIAP
Download sequence
Identical sequences A0A0E2JBU2 A0A2D2D9L8
gi|407456859|ref|YP_006735432.1| gi|407455453|ref|YP_006734344.1| gi|332287554|ref|YP_004422455.1| gi|332287554|ref|YP_004422455.1| WP_006343290.1.11713 WP_006343290.1.12211 WP_006343290.1.13912 WP_006343290.1.17627 WP_006343290.1.18414 WP_006343290.1.1931 WP_006343290.1.19843 WP_006343290.1.21207 WP_006343290.1.24561 WP_006343290.1.28891 WP_006343290.1.31403 WP_006343290.1.33036 WP_006343290.1.37886 WP_006343290.1.37937 WP_006343290.1.38386 WP_006343290.1.39749 WP_006343290.1.46040 WP_006343290.1.46631 WP_006343290.1.5305 WP_006343290.1.53856 WP_006343290.1.57788 WP_006343290.1.64751 WP_006343290.1.66441 WP_006343290.1.69777 WP_006343290.1.75063 WP_006343290.1.76581 WP_006343290.1.77465 WP_006343290.1.81755 WP_006343290.1.84771 WP_006343290.1.87516 WP_006343290.1.91940 WP_006343290.1.97314 WP_006343290.1.99633 gi|384453658|ref|YP_005666254.1| gi|392376786|ref|YP_004064564.1| gi|407454172|ref|YP_006733280.1| gi|384452682|ref|YP_005665279.1| gi|384451708|ref|YP_005664306.1| gi|384454637|ref|YP_005667232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]