SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387129824|ref|YP_006292714.1| from Methylophaga sp. JAM7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387129824|ref|YP_006292714.1|
Domain Number 1 Region: 16-405
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.09e-141
Family ArgJ-like 0.000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387129824|ref|YP_006292714.1|
Sequence length 408
Comment glutamate N-acetyltransferase / N-acetylglutamate synthase [Methylophaga frappieri]
Sequence
MAVNLLPPDAADLLPIQGIRLATASAGIKKPGRQDVVLIEIAEHSATAAVYTRNAFCAAP
VQICREHQKKTSPRYLLINSGNANAGTGQQGMQAARQSCQAVSEVTGVSSHAVLPFSTGV
IGQQLPVDKIEAVLPDAVANLQADNWLGAAKAIMTTDTVAKARSVQCRLSGQVVTITGIA
KGAGMIRPDMATMLAYIATDAVISQPLLSVMLQKVMDESFNRITVDGDTSTNDACVLIAT
GRARQAEITELDSDDAQCFVEALTDLCRYLAQAIVRDGEGATKFISINVTGGADSAECRQ
VAYTIAHSPLVKTALFASDPNWGRILAAVGRSGLNALDLTKVDIALDEVQIVSAGQPAPD
YTEARGQAVMNQSELTIHVALGRGDLEDLVWTCDLSYDYVKINAEYRT
Download sequence
Identical sequences I1YGI4
WP_014703448.1.84016 gi|387129824|ref|YP_006292714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]