SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347756995|ref|YP_004864557.1| from Micavibrio aeruginosavorus ARL-13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347756995|ref|YP_004864557.1|
Domain Number 1 Region: 543-1026
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-122
Family ALDH-like 0.000000544
Further Details:      
 
Domain Number 2 Region: 168-518
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.37e-109
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000277
Further Details:      
 
Domain Number 3 Region: 14-167
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.29e-43
Family N-terminal domain of bifunctional PutA protein 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347756995|ref|YP_004864557.1|
Sequence length 1041
Comment proline dehydrogenase [Micavibrio aeruginosavorus ARL-13]
Sequence
MTALRAMTPPNVTDHDLAPYLYADETVRVNTLLVDLAWKAERAERVGKAASDLVTRVRGA
RRKAGELEAFMQEYRLTTDEGLALMGLAEALLRVPDAKTADALIRDKITAADWAPEGAVN
DWMVKATGLGLSVTKATLESVVAKLGEPVIRTAMGQAIRIMGHQFVLGRTIDEGMKNAQA
YEAKGYRMSYDMLGEGARTMADAERYFNSYVSALNVIAANGKTVNGVMPGISVKLSALHP
RYRYSQADHCIPALTDKLMDLARVAAAKDVALTVDAEEVERLEISLDIIGAVAADPSLKH
WDGLGLAVQAYSKRTYPLIDRLAAMARAEKRRLSVRLVKGAYWDTEIKRAQVMGLRDYPV
FTRKCNTDLSYLACAQKLIQNRDVFYPMLATHNAHTVAAVLDMVRENGGAAAGPFEFQRL
HGMGEALYDIVLDDAKQSENIRVSMYAPVGTHEDLLPYLVRRLLENGANSSFVNKLLDPK
VPVEDAVEDPIADVKRNETRRHPRIPLPADLYGMGRKNSAGMDLTDPDVVGPLIPAMKAA
VDDVEWVAAPLIGGKLYRDGAMIPVTNPAHRDHVVGHAVYAGADHVKRAFETARNGFAVW
SATPTRDRAACLDRLADLMQDYAIPLMGLCVREAGKTMDDAVAELREAIDFCRYYAMRGR
IDFVDHGHVMPGPTGENNVLNLHGRGTFVCISPWNFPLAIFMGQVSAALMAGNAVIAKPA
EQTPLIASLAAKLIHMAGVPHDAFTLLPGDGHVGAALVAHPDVAGVAFTGSTEVARIINR
TLAAKDGPIVPLIAETGGQNAMIVDSSALPEQVVDDAMISAFGSAGQRCSALRVLCLQDD
VADKIITMLRGAMEQIRIGDPMDIRTDIGPVIDDEARQILVKHRAAIEGFGKIVASAPLP
MGAEKQGTFFAPVACEIKSISDLKREVFGPVLHIIRYKASERDAILKAVNDTGYGLTFGI
HSRIQSTIHDLADGAHAGNVYVNRTMIGAVVGVQPFGGHGLSGTGPKAGGPYYLPRFATE
KVISVNTTASGGNASLVSLDD
Download sequence
Identical sequences G2KP47
WP_014101778.1.28181 gi|347756995|ref|YP_004864557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]