SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Wbm0019 from Wolbachia endosymbiont of Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Wbm0019
Domain Number 1 Region: 295-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.5e-46
Family Ribonuclease PH domain 1-like 0.0000268
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-44
Family Ribonuclease PH domain 1-like 0.0000805
Further Details:      
 
Domain Number 3 Region: 446-543
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 137-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-20
Family Ribonuclease PH domain 2-like 0.0073
Further Details:      
 
Domain Number 5 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000018
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 246-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000249
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0056
Further Details:      
 
Domain Number 7 Region: 604-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000123
Family Cold shock DNA-binding domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Wbm0019
Sequence length 755
Comment | Wolbachia-Brugia malayi polynucleotide phosphorylase/polyadenylase (756 aa)
Sequence
MFEIIKKSIEWGGRTLSLETGKIARQADGSVVVNYGDTSILVTVVRKKKEEIVDFLPLNV
QFIAKSYAMGRIPGGFFKREGKPSDRETLISRVIDRSIRPLFLEGFHDEISIVCNLLTYD
TVNPPEVPALIGAVAALAISGVPFHFIIAGVLVGCDGNNNYILNPSVQEMKVSSLDLFLS
GDERSILMVESEAKELPEENILNAIKFGHEHLQPVIKLIKEFADTIGNKFDSFAPIDISD
IMQDLEKHSKDFEEAYSQTVKQERAQTLETIRNNILNPLKEAGKDEKLITQAVKNFERSL
LRKIIREKGTRIDGRKYDEIRQIEVEVDILSRTHGSALFTRGSTQALVVTALGTTQDEQI
VDDIEGDRREHFMLHYNFPSFAVGDASAIRAPGRREIGHGKLAWKAIHPVLPDKSEFPYT
IRVVSEIMESDGSSSMATVCGTSLALMDTGVPIKSPVAGIAMGLIKDKNDYVILSDILGD
EDYLGDMDFKVAGTSEGITALQMDMKISGISFEIVEKSLEQAKAGRLHILEKMNSVISEH
SDDVKGHAPRMVSFYIDKDKISAAIGAKGKNIRSVCERSNAKIEIGDDGKVSVFAMSSAE
AEIAKNMMIDSITELEQGAIVDVKVVKIDKSIVELELFNGRKGKMHISEVANQHIESIES
ILKQGDTFKALVIDFEKGGCPKLSRRRVDQETGDFFEGELYNEEKKDSSNDRDYYNSPFN
RKSGHRKRPVHSRSSFSNRNNRPKFGNDDSSSSFY
Download sequence
Identical sequences Q5GTR3
292805.Wbm0019 Wbm0019 gi|58584280|ref|YP_197853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]