SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557222206|ref|YP_008762421.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557222206|ref|YP_008762421.1|
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.07e-114
Family FMN-linked oxidoreductases 0.00000000239
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.59e-44
Family N-terminal domain of adrenodoxin reductase-like 0.00000829
Further Details:      
 
Domain Number 3 Region: 465-523,561-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557222206|ref|YP_008762421.1|
Sequence length 678
Comment NADH:flavin oxidoreductase [Pseudomonas sp. VLB120]
Sequence
MAADRYPHLLAPLDLGFTTLRNRTLMGSMHTGLEERPGGFERMAAYFAERARGGVGLMVT
GGIAPNDEGGVYSGAAKLSTEEEADKHRIVTDAVHAAGGKICLQILHAGRYAYSPRQVAP
SAIQAPINPFKPKELDEAGIEKQIADFVNCAVLAQRAGYDGVEVMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLAVEIVRRVREAVGPAFIIIFRLSMLDLVEGGSSWNEIVLLAQA
IERAGATLINTGIGWHEARIPTIATKVPRAAFTKVTAKLRGAVKIPLITTNRINTPEVAE
AVLAEGDADMVSMARPFLADPDFVNKAAEGRADEINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYLPVTKVKRIAVVGAGPAGLAAATVAAERGHEVTLFDAADEVGGQFNVAK
RVPGKEEFFETLRYFRNKVRSTGVELRLNTRVDVEALVQGKFDEIILATGIVPRTPAIPG
VEHNKVLSYLDVLLERKPVGKSVAVIGAGGIGFDVSEYLVHQGVASSQDRDAFWKEWGID
THLEARGGVAGIKAQPHAPARQVYLLQRKKSKVGDGLGKTTGWIHRTGLKNKHVQMLNSV
EYLKIDDDGLHIRVGEGEPQVLAVDNVVICAGQDPLRELHEGLAAAGQSVHLIGGADVAA
ELDAKRAINQGSRLAAEL
Download sequence
Identical sequences U5VBY3
gi|557222206|ref|YP_008762421.1| WP_023379484.1.72310 WP_023379484.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]