SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557222673|ref|YP_008762888.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557222673|ref|YP_008762888.1|
Domain Number 1 Region: 237-517
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.98e-88
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 23-270
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.27e-73
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557222673|ref|YP_008762888.1|
Sequence length 535
Comment propionyl-CoA carboxylase [Pseudomonas sp. VLB120]
Sequence
MAILHTQINPRSAEFASNSAAMLEQVQALRSLLAQVSQGGGPKAQERHTSRGKLLPRERI
DRLLDTGSPFLEIGQLAAHEVYGEDVPAAGLIAGIGRVEGVECMIVANDATVKGGSYYPL
TVKKHLRAQTIALQNRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSALGIAQ
IAVVMGSCTAGGAYVPAMADEAIMVRQQATIFLAGPPLVRAATGEVVSAEDLGGADVHCR
TSGVADHYADNDEHALALARRSVANLNWHKLGKLQRQTPIAPLYSAEELYGVVPADAKQP
FDVREVIARLVDGSVFDEFKALFGTTLVCGFAHLHGYPVAILANNGILFAEAAQKGAHFI
ELACQRGIPLLFLQNITGFMVGKKYEEGGIAKHGAKLVTAVACAQVPKFTVIIGGSFGAG
NYGMCGRAYDPRFLWMWPNARIGVMGAEQAAGVLAQVKREQSERSGQPFSAEDEARLKQP
ILDQYEHQGHPYYSSARLWDDGVIDPAQTRDVLGLALSASLNAPIEQSRFGIFRM
Download sequence
Identical sequences U5VGI1
gi|557222673|ref|YP_008762888.1| WP_023379985.1.72310 WP_023379985.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]