SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557222718|ref|YP_008762933.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557222718|ref|YP_008762933.1|
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.24e-80
Family Crotonase-like 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557222718|ref|YP_008762933.1|
Sequence length 270
Comment enoyl-CoA hydratase [Pseudomonas sp. VLB120]
Sequence
MTDYSAFKVEQTDNIAHVQINRPEKINAMNAAFWEEIVDIFQWIDDTDAVRAVVISGAGK
HFSSGIDLMMLASLAGQMGKDVGRNARLLRRTILRLQASFNAVDNCRKPVLAAIQGYCIG
GAIDLVSACDMRYCSQDAQFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRMVDA
DEALRIGLVNRVYDDQAALLDGVFAIAREIAAKSPIAVAGTKEMLSYMRDHRIDDGLEYI
ATWNAAMLQSEDLRVAVAAHMSKQKPTFAD
Download sequence
Identical sequences U5VGM6
gi|557222718|ref|YP_008762933.1| WP_023380030.1.72310 WP_023380030.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]