SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557223219|ref|YP_008763434.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557223219|ref|YP_008763434.1|
Domain Number 1 Region: 9-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.43e-80
Family Crotonase-like 0.000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557223219|ref|YP_008763434.1|
Sequence length 257
Comment enoyl-CoA hydratase-isomerase [Pseudomonas sp. VLB120]
Sequence
MPRYLDVQAPESGVRLITLQRPEALNALCTELLEQLAAELEDAERDEHTQVVVLTGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQRIATFAKPLIAAVNGYALGGGCELVMCSDIVI
AGEDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAIGARHALQAGLVSEIT
QPELTVERALQVARSIAAKAPLAVRLAKEALLKAGDIDLASGLRFERHAFTLLAGTADRD
EGVRAFMEKRPARFTGR
Download sequence
Identical sequences U5VEL4
gi|557223219|ref|YP_008763434.1| WP_023380587.1.72310 WP_023380587.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]