SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557224336|ref|YP_008764551.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557224336|ref|YP_008764551.1|
Domain Number 1 Region: 67-189
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000981
Family Apolipoprotein 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557224336|ref|YP_008764551.1|
Sequence length 287
Comment lipoprotein [Pseudomonas sp. VLB120]
Sequence
MHVRLLKVLLIAIGSLLALVACNRIDLAYRNLDRLVPWSLADYLDMNSDQKALLDERLKQ
HLAWHCKTQLPGYLDWLDRVRTMVAEDQVTDQALQQRTQEARQAIGRVTEAITPSAAELL
RGMSDAQVEEMREALREDISERQKKYVDTPLEQQITRRTERMEKRLRPWFGELNTAQRQR
IQAWSQSLGDQNREWITNRAHWQQQLMLAMNQRNDASFEPRLAQLLQRKESLWTENYRIA
YQNTERQARSLLVDLMHLSTPAQRTFLQQRLAEVRTDFSELKCLRSP
Download sequence
Identical sequences U5VHY1
WP_023381725.1.72310 gi|557224336|ref|YP_008764551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]