SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557224574|ref|YP_008764789.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557224574|ref|YP_008764789.1|
Domain Number 1 Region: 5-314
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.06e-100
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557224574|ref|YP_008764789.1|
Sequence length 315
Comment acetyl-CoA carboxylase carboxyltransferase subunit alpha [Pseudomonas sp. VLB120]
Sequence
MNPNFLDFEQPIADLQAKIEGLRLVGNDNSLNISDEIARLQDKSNTLTESIFGNLTSWQI
ARLARHPRRPYTLDYLEHIFTEFEELHGDRHFADDAAIVGGTARLDGKPVMVIGHQKGRE
VREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFIDTPGAYPGIDAEERNQSEAIAW
NLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQYSTYSVISPEGCASILWKTADR
AADAAEAMGVTAERLKSLNIVDKVIEEPLGGAHRDPVKMSESIRADLIQQLDMLGKLDND
ALLARRYERLMSYGL
Download sequence
Identical sequences U5VIK2
WP_023381960.1.72310 WP_023381960.1.91273 gi|557224574|ref|YP_008764789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]