SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557224927|ref|YP_008765142.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|557224927|ref|YP_008765142.1|
Domain Number - Region: 407-491
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0876
Family Apolipoprotein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557224927|ref|YP_008765142.1|
Sequence length 724
Comment hypothetical protein PVLB_21180 [Pseudomonas sp. VLB120]
Sequence
MQKEGKVVPLAAAIDRGVRTPLPCLPMLLLQVRDKAALQLRQALQDLFDNADDTLFEMAD
KAAERFDQNLYFEAMRDLRLKRKSIERGFLDIYHDAFARLGRVDPLAGLSQPDSPRGQAQ
LERAAAVDGMIARVLSRDGLALGQLNLRFQTLLGHALDDWHNPLEPGALCGYFLDAGRSL
GVGLRVKLVLLKLFERYVLRDIDVLYGEANQLLAAAGVLPDLQPAPRRRAEDRQRASRRA
LAAEVREDVTGQNAAGQAFFDSLQGLLAPERGRFAPRLQAVATAHPISTADLLRLLSHLQ
QYVPATYEPEDFVLGQQLEQLLLRVSVRSGTRRRIATADEDMINLVGLLFDFILADDNLP
PSLRALLGRLHIPVLKVALLDKGVFSRPSHPVRRLLNELAAASFGWDAHAQGLRDSLHLR
VERIVQRLLNDFTDDVGLFAELLEDFVTFNQDERRRNELLEQRTRDAEEGRARALQARQQ
VQQALNQRLRGHVWPQVVVQMLVQSWSQVMMLAWLKQGEASLAWVNALATLDALLASIAP
HHGPRACERLLQQVPGLLKALRDGLAGVAQDSAATREFFLALERLHLRACAGGEPSTVDD
DPALAEVLVGDDIVLSIAEEPACAPLRQSDGLAMHMQQVQRLRIGSWVEVFDDEEPLRCK
LVARIDGTDRLVFANRTGMKAREWSTAGLAQALRHGEARLLDDGQLFERALETVLDRLRQ
QHAH
Download sequence
Identical sequences U5VML7
WP_023382306.1.72310 gi|557224927|ref|YP_008765142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]