SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557225954|ref|YP_008766168.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557225954|ref|YP_008766168.1|
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.19e-85
Family Crotonase-like 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557225954|ref|YP_008766168.1|
Sequence length 263
Comment enoyl-CoA hydratase [Pseudomonas sp. VLB120]
Sequence
MTFEHILFSVEAGVATLSLNRPEQLNSFNAAMHGEVREALKRVRQNPEVRVLLLTGEGRG
FCAGQDLADRNVAPGAEAPDLGESIEKFYNPLIRTLRDLPLPVICAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLIPDSGGTWSLPRLVGLARAKALALLGERLTAEQAEQWG
LIYRVVDDAELRDEALKLARHLATQPTYGLALIKRSLNASLNNDFDAQLDLERDLQCLAG
RSEDYREGVAAFMAKRTPVFKGR
Download sequence
Identical sequences Q845K1 U5VQV9 V4GGZ3
WP_019436609.1.42045 WP_019436609.1.48025 WP_019436609.1.72310 gi|557225954|ref|YP_008766168.1| gi|557225954|ref|YP_008766168.1|NC_022739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]