SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557222294|ref|YP_008762509.1| from Pseudomonas sp. VLB120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|557222294|ref|YP_008762509.1|
Domain Number - Region: 12-84
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0113
Family Crotonase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557222294|ref|YP_008762509.1|
Sequence length 171
Comment hypothetical protein PVLB_07910 [Pseudomonas sp. VLB120]
Sequence
MAQELYTRTNQKLFFAGLALESMAKAEQSQAMNAQGLVQAEREAALFHLNGALLGLCHEI
GGFYRLPVVASVEQALADDALNDIAIPEVAEMLELVRQRETWLAQLVSAYADLFRPPVAK
KTPKTDVTQPLIQAVNLDEPEQPALSRATLESWRNNLKDLVRRFRDALSEC
Download sequence
Identical sequences U5VBX6
gi|557222294|ref|YP_008762509.1| WP_023379576.1.72310 WP_023379576.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]