SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336119602|ref|YP_004574379.1| from Microlunatus phosphovorus NM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336119602|ref|YP_004574379.1|
Domain Number 1 Region: 6-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.44e-50
Family Isochorismatase-like hydrolases 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336119602|ref|YP_004574379.1|
Sequence length 211
Comment hypothetical protein MLP_39620 [Microlunatus phosphovorus NM-1]
Sequence
MSDAATGLTLDPATTAVVLIEYQNDFTSEGGALHGAVAEVMGSTDMLAKTKALASAARSA
GATIMHAPITFVAGYHEISSHPYGILKGVVDGNAFVKDTWGAAIVDDLAPQPGDIVIEGK
RGLDTFASTNLDFILRSKGITTIVLGGFLTNCCVESTMRTGYENGYRVVTVTDCTAATST
AEHESAIRFDYPMFSLPVSADDVINALAGAA
Download sequence
Identical sequences F5XQV4
WP_013864818.1.71618 gi|336119602|ref|YP_004574379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]