SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336119114|ref|YP_004573888.1| from Microlunatus phosphovorus NM-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336119114|ref|YP_004573888.1|
Domain Number 1 Region: 472-579
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000314
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336119114|ref|YP_004573888.1|
Sequence length 629
Comment sulfate transporter [Microlunatus phosphovorus NM-1]
Sequence
MNPIRRRPHIDYELDAGGRRSLWQTLPTLTPGLGVLRHYERRWLRLDGFAGIAVVAYMVP
QVMAYTAIVNVPPVVGLWTALAACVVYAIIGGSRVLSVGPESTVALMAGAAIAPLAGGDP
ERAIVLSSALCLVVAGWCLLARLFRLGIIADLLSQPLLVGYLAGGAVLMVVGQLGRVTGT
DVEGETIVAQLRSFFSVVGDTHLPTLAVAAGTLTLLLAIVILRPRWPGPLIAVAAATIAA
VVLDLPAYGVAETGPVPVGLPLPHLPIISWADLQTLLLAGLGVAVVAYSDNTLIGRAFKP
KTEPGEKSVPDVDPQQELVAMSGVHVAAGLFGGFPMSSSGSRTALAIASGARTQVYSLVA
AVCIIAVLFFAGPLLEPLPSAALGAVVIYAASKLVSIPDIKRLARFRTSELVLAIVACLG
TVLIGILAGVGIAIALSILEMVQRLARPHEGVLGRVEGIAGMHDVDDYDQATTLPGLVVY
RYDAPLFFINVGDLRRRALLAVEKENEGDPDHPVRWFILNAEANVEIDISATDGLKALHD
DLSERGIRFGLARVKQDLRTPLERAGLVELIGEDMMFPTLPVMEKAYLTWAAEQAVREQT
ALEHQAVPGADEPAGTPPARPVDTNESDR
Download sequence
Identical sequences F5XN35
gi|336119114|ref|YP_004573888.1| WP_013864341.1.71618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]