SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861913|ref|YP_006364152.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389861913|ref|YP_006364152.1|
Domain Number - Region: 291-431
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0144
Family Phase 1 flagellin 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389861913|ref|YP_006364152.1|
Sequence length 495
Comment cell envelope-related transcriptional attenuator [Modestobacter marinus]
Sequence
MAFDDGARPLPPHLDPRAGRSAHPAAPGRGGSRLAVVARVVAALLSLALLLGSGWGWYLA
RVAEASIGRTDAIPTEGNTDAQGSDHAGKAMNLLLVGRDSRAGLTAEQAAEFSTGDPEGL
LNTDTMILVHIPADGSAAAFVSIPRDLYVSIPGYGESKLNSAFGRGYNDEEGSEADKEAA
GARLLIQTISGVTGVQIDHFAEINLLGFINISSIVGGVEVNLCNATDDPLSGAHFEAGEQ
TISGAEALAFVRQRHGLPSELDRQVRQQVFLAGLIRNVLSQDLLLNPVKQRQVIQQVGTS
VTVDQGLNLFDLAAQMQSVKPDEISFQTIPGLVDARTDAGDVLEPADPDALKEFFASLSA
GADPDAAAPSVEAADPADVTVSVLNGSGVSGAAATAADALAAAGFDASSGGNAAATDVTT
VSAATGDEALAAAVAAEVPGAAVTVDDSLASGTVQLVLGADSNGIGQPVSAKAPETAPGT
YASSERTAEDTSCIA
Download sequence
Identical sequences I4EQI4
WP_014738264.1.28377 gi|389861913|ref|YP_006364152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]