SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389862641|ref|YP_006364881.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389862641|ref|YP_006364881.1|
Domain Number 1 Region: 43-400
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 8.37e-25
Family Soluble quinoprotein glucose dehydrogenase 0.0027
Further Details:      
 
Domain Number 2 Region: 409-492
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000392
Family PKD domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389862641|ref|YP_006364881.1|
Sequence length 939
Comment glucose/sorbosone dehydrogenase [Modestobacter marinus]
Sequence
MTGVEGDRATARPPGSVGALLVLLVLLATAAFAGLPPTPAAAAPLLPAGFAVRPLPSGQD
ELLTDFAFAPDGSWFTVGKNGRVAWVSADGRPRTLATLPVVTVQDLGLSGVAVAPDYETS
RQVYTVRTLDVAGRWVMRLSAWTVTGSPEPTGLGAERVVWDLPADADVHAMTSVLAAPDG
TLWVTVGDAADFRFVDARALRALDVDDGRGKVLHVLPDGRGVATNPYYDPAAPGSWRSRV
YASGFRSPFRMTLDPASGAPVVGDVGWNTWEEVDLVRPGASYGWPCWEGPVRTPGYAELP
GCQGVGNSAPLATYPHGPAGTSVTGGIVYTGANYPEAYRGAYFFGDYSSQRLYTMRYDAE
GDLVRAPEDAGFGVGNGLPVAFGAAPNGDVVYADIGGSVLQRLVYVPGNRPPTAQITLTS
DAATRTVAFDGTASGDLDGEVLTYRWDFGDGSTGTGAQVSHTYAAPSTAPVPVTLTVSDP
QGATGTSTATVVPANGAPVLTLGSPPAGRLFAVGDTVEATATATDAEDGALPVTWSEVLV
HCSGGYCHQHPGETVTGGTFSRPFVDHGDDTRVEITASARDSAGVRVQQTFEAAPRLRTL
TVTASTPGAVTVNGVARASSRLTVGAQVSVIAPVVATDGVATFERWTDGSPRARELTMPD
EDVALSADYLTPIDRRYATDPALRAVLGAPTAPEAGDETLRYLTTTGGRVYWSPAAGVHE
VHGAVLTAYLAEGGHVRFGPPLTDERTAPDGVGRYNQFAALGAAVYWTPATGARAVYGDI
GARWAALGWERGVHGYPRSSELGTPDGRGRYNDFADGGIYWLPGVGARSVVGAIYGAWAR
AGWEGGRLGFPVTDETGTPGGAGRFNHFERGSVYWTPATGAHVVEGDILRRWAALGWERS
SLGFPTSDEYAVPGGRRSDFQGGSLTWDAATGQVTESLR
Download sequence
Identical sequences I4ESM3
WP_014738992.1.28377 gi|389862641|ref|YP_006364881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]