SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389862749|ref|YP_006364989.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389862749|ref|YP_006364989.1|
Domain Number 1 Region: 1-302
Classification Level Classification E-value
Superfamily Phase 1 flagellin 6.54e-54
Family Phase 1 flagellin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389862749|ref|YP_006364989.1|
Sequence length 302
Comment flagellar hook-associated protein 3 [Modestobacter marinus]
Sequence
MRITQRAITQNSLLGLNSNLAALDKLQQQLTSGTTISRPSDSPTGTNTSMLTRRSIADNE
QQARNITDGTGLLDATDTALQDMLAQTRKVRDLTVQALNGGVASPESAQAVSAQVTGLRE
SMLGQANQVIAGRPLFGGATSGTTAYDGTGAYVGVGGTGGIPIVPVNRRVSDTETIRADI
TGAEAFGDPAAGRDLFAVVQDIATHAAGRDQAGLTSDLAALDDAISRMTKATADVGTRAQ
RMEKAASTNQSRALTLSAQLGATEDVDLPKTIMNMQAQQVSYQAALQVTAQVLQPTLLDF
LR
Download sequence
Identical sequences I4ESY1
WP_014739100.1.28377 gi|389862749|ref|YP_006364989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]