SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389863439|ref|YP_006365679.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863439|ref|YP_006365679.1|
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.23e-35
Family G proteins 0.00021
Further Details:      
 
Domain Number 2 Region: 169-256
Classification Level Classification E-value
Superfamily Translation proteins 1.85e-17
Family Elongation factors 0.00086
Further Details:      
 
Weak hits

Sequence:  gi|389863439|ref|YP_006365679.1|
Domain Number - Region: 537-573
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00204
Family C-terminal fragment of elongation factor SelB 0.01
Further Details:      
 
Domain Number - Region: 279-342
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00767
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389863439|ref|YP_006365679.1|
Sequence length 579
Comment Selenocysteine-specific translation elongation factor [Modestobacter marinus]
Sequence
MIATAGHVDHGKSALVRALTGMEPDRWEEERRRGLTIDLGFAWTTLPSGRRVAVVDVPGH
ERFIGNMLAGVGSVPTALVVVAADDGWSAQTAEHVAVLDALGVRAGLLAVTKADLADPAP
VLADARERLAGTSLGRLPAVAVSARTGAGLPELTAALERVLAGLPAPDPAAPVRLWVDRA
FTIRGAGTVVTGTLAAGTLTAGDRLDLGGRTVTVRGLQSLGAPVETAVATARVALNLRGV
AVEEISRGDALLTPDAFRRTADLDVTLVAPVEGTLPAEAVVHIGSATVAARVRPLDGTAV
RLRLAHELPLRVGDRLLLRDPGVRRVLGADVRDVDPPELRRRGAARSRAAELAEQPAGAE
GAAADLARRRFVRRADFVAMGWPVPAGTTTVGPWLVAPGLADELAARVPQVVARYRQLRP
LEPGPPLAVLRSALELPDVELVPAVVRAPLELREGRVVAADPGLPAAVQRAVDGIRARLA
AEPFAAPEAGDLVAAGLGTRELAAAVRAEQLVRIADGVYLAPGVAEVARARLAGLPSPFT
LSEARQAWGTTRRVAVPLAEWLDARGITVRLPDNTRRLR
Download sequence
Identical sequences I4EUX5
gi|389863439|ref|YP_006365679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]