SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389863748|ref|YP_006365988.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863748|ref|YP_006365988.1|
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000275
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389863748|ref|YP_006365988.1|
Sequence length 143
Comment hypothetical protein MODMU_2066 [Modestobacter marinus]
Sequence
MAAWLLWLIAAGLFAAGEMASLDLVLLMFAGGALGGMSAAFLTDSVPIQLLAFVVVSAAL
LVVVRPVAKRHLVDRTPEQIDGVAVYVGRTAVVSQRVDNESGLIRMGHDVWTARTQLDDE
VFEVGDEVRIVQIEGPIAYVGHC
Download sequence
Identical sequences I4EVT8
gi|389863748|ref|YP_006365988.1| WP_014740096.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]