SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389863760|ref|YP_006366000.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863760|ref|YP_006366000.1|
Domain Number 1 Region: 13-506
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.15e-191
Family Heme-dependent catalases 0.00000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389863760|ref|YP_006366000.1|
Sequence length 554
Comment catalase [Modestobacter marinus]
Sequence
MTDVASQGPAASEADRPVLTNRQGHPVYDNQNQRTVGARGPATLENYQFLEKISHFDRER
IPERVVHARGATAFGVFVADGTVGDEPVAKYTRAKLFQEKGKETPVALRFSTVAGGRDSS
EAARDPRGFAVKFYTEDGNWDLVGNNLGVFFIRDAIKFPDFIHSQKPDPVTFERQVANRV
FDFWSQTPEALHMMTLVLSPRGLPASYRFMQGFGVNTYKWVNAQGESQLVKYHWLPKQGL
KSWTDADAAVAQGRELGVHTKDLYEAIERGDFPSWDLHVQLMDDHEHPELDFDPLDDTKV
WPENEFPLRKVGTLTLNRTPVDFFTESEQIAFGTGVLVDGLDFSDDKMLVGRTFSYSDTQ
RYRVGPNYLQLPVNAPRTRVATNQRDGQMAYGVDRAEGTNPHVNYEPSITGGLREAQYPT
HDEQGPEITGRLTRKRIPRTDDYTQAGQRYLLSEQWEKDDLVANLIGNLSQCDRPIQERM
MWHLFMVEDELGQRVGEGLGISADDVRGLSPLQTQTLTEAELQRAANLGKNGPRDVTGLV
MTHCVPNEHVVLAQ
Download sequence
Identical sequences I4EVV0
WP_014740108.1.28377 gi|389863760|ref|YP_006366000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]