SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389863962|ref|YP_006366202.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389863962|ref|YP_006366202.1|
Domain Number 1 Region: 181-381
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 7.2e-44
Family ATP-dependent DNA ligase catalytic domain 0.00051
Further Details:      
 
Domain Number 2 Region: 383-506
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.2e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00097
Further Details:      
 
Domain Number 3 Region: 9-205
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.44e-27
Family ATP-dependent DNA ligase DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389863962|ref|YP_006366202.1|
Sequence length 510
Comment ATP-dependent DNA ligase [Modestobacter marinus]
Sequence
MLLADVLAVSAAVSATRSRTAKAQAIADLVRRAGDAEVEPVTAWLSGELRQGRLGLGWRT
LSRLTGEPAAEPSLTVGALDAALDELATTSGAGSAARRDALVGAVLAAATESEQQFLVRL
LTGELRQGALEGVVLDAVALAADVPAAAVRRAFMLSGRLPETAATALTGGVAALDAVQLQ
VGRPVRPMLASPGSSLDAALTDLGSEVTVEFKLDGARIQVHRDGDVVRVWTRTLREVTDG
VPELVDRIRALPCETAVLDGETLALDDDGRPRPFQDTMSRFGSDSADAGVLLSPFLFDVL
HLDGRDLLDEPLAVRLDALAGLLADDAHAALRMPGVRRPTAEQAAGVLDDALTAGHEGVV
VKALDAPYAAGRRGKAWQKVKPVHTLDLVVLGAEWGYGRRSGKLSNIHLGARDPDGGEPV
MVGKTFKGMTDELLDWQTATFPDLAAEQPPWGVLLRPELVVEIALDGAQRSPRYPGGVAL
RFARVLRYRPDKTAAEADTIDAVRALLAGG
Download sequence
Identical sequences I4EWF2
gi|389863962|ref|YP_006366202.1| WP_014740309.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]