SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389864265|ref|YP_006366505.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389864265|ref|YP_006366505.1|
Domain Number 1 Region: 7-259
Classification Level Classification E-value
Superfamily Cgl1923-like 4.45e-87
Family Cgl1923-like 0.0000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389864265|ref|YP_006366505.1|
Sequence length 287
Comment ATP-grasp superfamily enzyme [Modestobacter marinus]
Sequence
MIDPKSVADDLPELDDPVVVVAFEGWNDAGDAATDAVEHLELIWDADLLAALDPEDYYDF
QVNRPTVSLVDGVTRRIEWPTTRISVTKPPGSDRHVVLIRGIEPNMRWRSFCDELIELCQ
DLGVTTVVALGALLADTPHTRPTPVSGSAYDAESAAQWGVETSRYEGPTGILGVFADACV
QAGLPAVSFWAAVPHYVSQPPSPRATVALLTRVEEVLEVTVPLGTLPQQADEWVKTVDEM
AGEDDEVVEYVRSLEERATQSDLSQANGDQIAKEFERYLRRRGSSPS
Download sequence
Identical sequences I4EXA7
WP_014740612.1.28377 gi|389864265|ref|YP_006366505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]