SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389864333|ref|YP_006366573.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389864333|ref|YP_006366573.1|
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily PEBP-like 5.36e-47
Family Prokaryotic PEBP-like proteins 0.0000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389864333|ref|YP_006366573.1|
Sequence length 179
Comment hypothetical protein MODMU_2659 [Modestobacter marinus]
Sequence
MADRPVPPNPYDFLPQVPAFTLESTEIGHGERLPAPHTSGAMGVPGGEDRSPQLSWSGFP
DGTRGFAITVYDPDAPTTSGFWHWAVTGIPASVTELAGGAASDGLPAGAVQLRNDAGFAG
YVGAAPPAGHGTHRYYVVVHALDTDDLGVPAEATPAYLGFNLFSHTLARGTIVAEYDVE
Download sequence
Identical sequences I4EXH5
WP_014740680.1.28377 gi|389864333|ref|YP_006366573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]