SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389864747|ref|YP_006366987.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389864747|ref|YP_006366987.1|
Domain Number 1 Region: 519-828
Classification Level Classification E-value
Superfamily Aldolase 8.06e-76
Family HMGL-like 0.00000126
Further Details:      
 
Domain Number 2 Region: 84-363
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.6e-67
Family BC ATP-binding domain-like 0.00000624
Further Details:      
 
Domain Number 3 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.15e-39
Family BC N-terminal domain-like 0.0000773
Further Details:      
 
Domain Number 4 Region: 334-451
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 5.23e-38
Family BC C-terminal domain-like 0.000074
Further Details:      
 
Domain Number 5 Region: 825-885
Classification Level Classification E-value
Superfamily post-HMGL domain-like 4.32e-20
Family Conserved carboxylase domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389864747|ref|YP_006366987.1|
Sequence length 1117
Comment hypothetical protein MODMU_3077 [Modestobacter marinus]
Sequence
MFEKVLVANRGEIAVRAFRAAYELGAGTVAVFPHEDRNSVHRLKADESYEIGEPGHPVRA
YLDVGEIVRAAQRAGADAVYPGYGFLSENPELAEACAACFITFVGPSAAVLELTGDKSRA
IAAARAAGLPVLAGTEPSDDVYALLAAADAIEGPVFVKAVAGGGGRGMRRVTDRAELRGA
IEAAMREAESAFGDATVFCEQAVLDPRHIEVQVLADGEGNVIHLYERDCSVQRRHQKVIE
IAPAPNLDPELRERMCADAVRFAREIGYSCAGTVEFLVDREGRHVFIEMNPRIRVEHTVT
EEVTDVDLVQSQLRIAAGETLADLGLSQDAIVLRGAALQTRITTEDPANGFRPDTGRITA
YRSPGGASVRLDGAATLGAEVGAYFDSMLVKLTCRGRTWDLAVARARRAVAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIEERPQLLTARSSADRGTKMLSYLADVTVNRPHGERP
HLVDPTEKLPRLDLRQAPAEGSRDRLRALGPERFAADLRAQTALAVTDTTFRDAHQSLLA
TRVRTKDLVAVAGHVARATPELLSIEAWGGATYDVALRFLHEDPWDRLAALREAVPNVCL
QMLLRGRNTVGYTPYPEQVTSAFVAEAARTGIDVFRVFDALNDVSQMRPAIDAVRETGTA
LAEVALCYTADLSDPAEQLYTLDYYLRLAEQIVEAGAHVLAIKDMAGLLRPPAAATLVTA
LRERFDLPVHLHTHDTPGGQLATLMAAWQAGVDAVDGASAALAGTTSQPALSSIVAATDH
TDRATGLDLAAVNDLEPYWEAVRRVYAPFESGLPAPTGRVYTHEIPGGQLSNLRQQAIAL
GLGQRFEEVEAMYAAADRLLGRLVKVTPSSKVVGDLALQLVGAGVRGRRLRRRPRRARPA
RLRRRVPARRARRPARRLARAVPQPGPGGTAPRRAARRAHRRRPPGPGRPAAGDAEPAAV
PGPGEGVPRPPGRLRRHQRAAQQGVPLRAARRYRALRRPRARCPAAHRHRGGLRRRRPRH
AHGDVHDERPAAAGVGAGPVRLGRRPAGGEGRPQRPRPGGRAVRRRRHPGGVRGRPGGGR
GPGRHDRGDEDGGLDHRAAGGLGDPGGDRRRPAGRGR
Download sequence
Identical sequences I4EYN9
gi|389864747|ref|YP_006366987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]