SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389865701|ref|YP_006367942.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389865701|ref|YP_006367942.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.31e-24
Family DNA-binding N-terminal domain of transcription activators 0.0045
Further Details:      
 
Domain Number 2 Region: 114-259
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.45e-16
Family Rob transcription factor, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389865701|ref|YP_006367942.1|
Sequence length 264
Comment MerR family transcriptional regulator [Modestobacter marinus]
Sequence
MLTIGEFAQLTHLSVRTLRRYHDAGLLEPARVDQASGYRYYSAEQIPAAQVIHRLRELDV
PLPDVQRILQTPDPGTRAGLVADHLQRLEDQLERTRAAVTSLQRLLRPEPATLDVELRAV
PATTVAAVEATVELDDVLAWYSGAMAELDALVGTPGPPGGLYDNELFTTGRGRVLVHRPV
TAPPRTGRVHPVTLPAVELAVTTHVGDHDTIDVTYGELGSWVVEHTLAVAGPVRETYLVG
PRDDPDPTAWRTEIGWPVFRLAPG
Download sequence
Identical sequences I4F1F6
WP_014742044.1.28377 gi|389865701|ref|YP_006367942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]