SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389865869|ref|YP_006368110.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389865869|ref|YP_006368110.1|
Domain Number - Region: 23-97
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00311
Family Heme-dependent catalases 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389865869|ref|YP_006368110.1|
Sequence length 228
Comment hypothetical protein MODMU_4244 [Modestobacter marinus]
Sequence
MADLADAAGRLVAGPVAALTRVRGAKPMHPRGTLFTAVLERTGLAAGIPWLDAAGRDDVL
VRISRGAGLPPALPDLLGLALRVPGERPVDLLLSSTGRGRWTRRVPVLRRDAATTYGSIM
AYRSARGPVLLAADPAGGPLPTDGDRLAAAAPGRVVRLSAAVGRGPWQLFGTVTLGEPST
PPDPELPFDAVQHPPPGLVADGPMARFRRPAYAAARAARGVGSETGLR
Download sequence
Identical sequences I4F1X8
gi|389865869|ref|YP_006368110.1| WP_014742210.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]