SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389866081|ref|YP_006368322.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389866081|ref|YP_006368322.1|
Domain Number 1 Region: 118-155,182-364,522-630
Classification Level Classification E-value
Superfamily Subtilisin-like 2.75e-66
Family Subtilases 0.00047
Further Details:      
 
Domain Number 2 Region: 399-495
Classification Level Classification E-value
Superfamily PA domain 0.00000131
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389866081|ref|YP_006368322.1|
Sequence length 1073
Comment subtilisin [Modestobacter marinus]
Sequence
MRPAGLPESGPTSFFMELAAPAASQVYSDVLTRSGAAAAASAASTARGDSEAAAAQVVDE
LPTAVPDAAVLYSTASVLSGVAVRADAADYEALSALPGVTAVHPITPKTVSNAGAAGVVQ
AVQAWEALGNTGKGVSIGVIDTGIDYTHTDFGGSGSVADYAALQAAEAQPAPAGVFPNAK
VVGGHDFVGDAYNADPADPAYDPVAKPDDNPLDCNGHGTHVAGTSAGYGVNADGTTYRGG
YGPGLDPKALRIGPGMAPEADLYALKVFGCEGSTDVTIQAIDWALDPDQDGDPSDHLDVV
NLSLGSDYGLADDADALAIDQAMELGMLAVVAAGNAGDSYDIGGSPGNAPRGIGVAASND
GYGVFDGWRVLSPAGVLDGVRPGLRSVAYSDTDDAGAVKPDVTGDLIAAPTGNEDACAAL
PAGYATGKVLLIQAAGFACGSVAKGTNAVAAGAIAFVIVSDDDLLETGITGVPQIPGILT
TATDGQALETAVGAGQTVTVTFGPSLKDAAVADDPEQVDLLASFSSRGVRQADGVKPDVT
APGVTLFSAGVGTGSAGVSESGTSMATPTTAGVTALIRAAHPEWTTEEVKADLMNTAVHD
VYTGEGRTGEVYGPNRTGSGRIDAAAAVQNTVLAYAEAGSGVVSASFGVVEVAAEQVQAT
RTITVANKGTSAAVYRVAYQAAAEQPGVRYSLSAQRVTVPPGQTRTVTVTMTAVQDELRK
VADPTVVTDDGRQFLGEASGRVVLTPVNGKGSALRVPVHSNAKPSSTLTASAAADGSTIT
LSGQGVANGEAYQPSSYTSLVDVVEQLGTSPEMPRCTTTVGPDCYKSELERSVDLAAVGV
ASDVRAFADDPGLYFAVSAHGRYTSPETAVNYGVYLDATGDGVWDYQVTTTRVADSDVAL
VVVTDREFQLLPAGDPYVGALDLVDGLVDTNAYDSDVQVMGVPLSAMPLVQGRISFGVQA
VSAYDTVDDLGTTTGATGAELSTPMSFDPLAPGLSFSDPDGNPALLLPAADGTTITVTQD
PASYAADVAVGGEKGALVVLPHNDTATGRSQSVPVPAVAADATVSPVEAPPAG
Download sequence
Identical sequences I4F2J5
gi|389866081|ref|YP_006368322.1| WP_014742422.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]