SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389866664|ref|YP_006368905.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389866664|ref|YP_006368905.1|
Domain Number 1 Region: 22-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-56
Family G proteins 0.000000507
Further Details:      
 
Domain Number 2 Region: 328-431
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.2e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 238-326
Classification Level Classification E-value
Superfamily Translation proteins 2.29e-19
Family Elongation factors 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389866664|ref|YP_006368905.1|
Sequence length 435
Comment sulfate adenylyltransferase [Modestobacter marinus]
Sequence
MAAPIDVHSAVAEAAAEIAHARKDILRIATAGSVDDGKSTLIGRLLFDSKAVFEDQYAAI
ERASRGDYVDLALLTDGLRAEREQGITIDVAYRYFSTPRRTFILADTPGHVQYTRNMVTG
ASTADLAIVLVDARKGMVEQSRRHAFLASLLRVPHLVVAVNKMDLVDWSEEVFERIRDEF
SAFATKLDVPDLTVVPISALQGDNVVTRSANMPWYEGTSLLHHLEHVHVASDRNLVDTRF
PVQYVIRPQSDAFHDYRGYAGRVAAGVLRPGDEVQVLPSGLTTTIAGIDGPDGPVDAAFP
PMSVTVRLSDDLDVSRGDLICRPHNAPQVTQDLDALVCWMADTPLVPRMRLAVKHTTRTV
RAMVKELQYRLDVNTLHRETDAPQLGLNDIGRVRLRTTQPLFVDDYHRNRVTGRFILIDE
ATNATVGAGMLTPAG
Download sequence
Identical sequences I4F483
WP_014743001.1.28377 gi|389866664|ref|YP_006368905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]