SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389866892|ref|YP_006369133.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389866892|ref|YP_006369133.1|
Domain Number 1 Region: 101-177
Classification Level Classification E-value
Superfamily Single hybrid motif 1.83e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.0008
Further Details:      
 
Weak hits

Sequence:  gi|389866892|ref|YP_006369133.1|
Domain Number - Region: 6-44
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.000129
Family Conserved carboxylase domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389866892|ref|YP_006369133.1|
Sequence length 178
Comment pyruvate carboxylase [Modestobacter marinus]
Sequence
MAEEPRPTLNRLLFPGPTKEFRAHREAYGDTSVLPSKEFLYGLRTNTEHSVDLEPGVRLL
IGIEAVSDADERGMRTVMCTMNGQLRPVSVRDRSVSADVQPAEKADRSDPGQVAAPFAGV
VTLAVSEGDQVEAGAQVGTIEAMKMEASITAPRAGSVTRVAIGAVQQVEGGDLLVVLG
Download sequence
Identical sequences I4F4W1
gi|389866892|ref|YP_006369133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]