SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389867105|ref|YP_006369346.1| from Modestobacter marinus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389867105|ref|YP_006369346.1|
Domain Number 1 Region: 166-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-66
Family Methylesterase CheB, C-terminal domain 0.00000615
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily CheY-like 1.08e-31
Family CheY-related 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389867105|ref|YP_006369346.1|
Sequence length 370
Comment chemotaxis response regulator protein CheB-glutamate methylesterase [Modestobacter marinus]
Sequence
MNEIRVMVVDDSVVVRKIVTDVLSEDPMITVVGTAPNGRLAVAKLEQLKPDLITMDIEMP
EMNGIEAVRAIRATRNRVPIIMFSTLTERGASATLDALSAGANDYVTKPANVGSVAQSME
SVRQQLTPKIKALTGRPLTGGPTAAPAAAPVAVRPPAPRARAPKEPAVLVIGSSTGGPEA
LTKVLPLLPASLPVPVLLVQHMPPVFTRQFAQRLDRLCALTVVEAADGTPLLPGTVHIAP
GDFHLTIGSSGAARRTALNQAPPENFCRPAVDVLFRSAVAAYDGAVLGVVLTGMGSDGRV
GAGQIREAGGSVIAQDQATSVVWGMPGAVTQAGFADEVVPLGRVAEAVLRLLPTPRPAAA
FAAARAGGLR
Download sequence
Identical sequences I4F5H4
gi|389867105|ref|YP_006369346.1| WP_014743442.1.28377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]