SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344201988|ref|YP_004787131.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344201988|ref|YP_004787131.1|
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.32e-27
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344201988|ref|YP_004787131.1|
Sequence length 71
Comment translation initiation factor IF-1 [Muricauda ruestringensis DSM 13258]
Sequence
MAKQPAIEQDGTIIEALSNAMFRVELENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPY
DLTKARITYRY
Download sequence
Identical sequences A0A0Q1C1Z2 A0A1H2Q6V6 A0A1I6U063 A0A1M5NSA5 A0A1M6AXT5 A0A1T5E464 A0A1Y0MQG4 A0A1Z8MFK3 A0A285MWP9 A0A2E1AUW2 A0A2E2SGK1 A0A2E2W9U0 G2PSN6 W2URJ1
WP_014031991.1.1840 WP_014031991.1.27040 WP_014031991.1.27196 WP_014031991.1.27466 WP_014031991.1.32214 WP_014031991.1.40830 WP_014031991.1.41749 WP_014031991.1.48532 WP_014031991.1.7235 WP_014031991.1.75520 WP_014031991.1.77066 WP_014031991.1.82675 WP_014031991.1.94118 gi|344201988|ref|YP_004787131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]