SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344204358|ref|YP_004789501.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204358|ref|YP_004789501.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.64e-20
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344204358|ref|YP_004789501.1|
Sequence length 64
Comment cold-shock DNA-binding domain-containing protein [Muricauda ruestringensis DSM 13258]
Sequence
MSKGTVKFFNDSKGYGFITEDGSNTDHFVHISGLIDEIREGDVVEFELQQGKKGLNAVNV
QVAD
Download sequence
Identical sequences A0A1Z8MDF5 A0A2E3VS34 G2PKN3
WP_014034358.1.32214 gi|344204358|ref|YP_004789501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]