SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344204561|ref|YP_004789704.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204561|ref|YP_004789704.1|
Domain Number 1 Region: 15-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.32e-54
Family PP-loop ATPase 0.0000372
Further Details:      
 
Domain Number 2 Region: 348-432
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000706
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344204561|ref|YP_004789704.1|
Sequence length 436
Comment tRNA(Ile)-lysidine synthase [Muricauda ruestringensis DSM 13258]
Sequence
MFPKFKQHINSEMPFLKGKKLLLACSGGVDSVTLAHLCVAADLDIGLAHCNFTLRSDESD
GDEVFVRQLATTLGIEVFVKQFETEQYAQTHRLSVQMAARELRYQWFSELLETKGFDYIL
TAHHANDSLETFLINLSRGTGIEGLSGIPEVNEQVVRPLLPFSQQEILAYAKSEKIAWRE
DSSNASTKYLRNKIRHQIVPVLKELHPTFLQNFLNTQNHLQQTNSLASNHLNELKSKLFE
QRDGDIKISITALEKLQPLDAYLYGLFKDYGFTEWNDVKDLLSAMSGKQVVSKTHRLLKD
RDFLILSEIKNTVNGTYLVHVDGTPSELPIKLKLENVETLEKQGRNVVFLDKEKLNFPLV
LRNWEKGDYFYPFGMQGKKKLSKFFKDEKLDVISKEKQWLLCSSDNEIVWVVGKRADERF
KVEDSTRQIIKITQLT
Download sequence
Identical sequences G2PME9
WP_014034560.1.32214 gi|344204561|ref|YP_004789704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]