SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344204702|ref|YP_004789845.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344204702|ref|YP_004789845.1|
Domain Number 1 Region: 216-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-67
Family B3/B4 domain of PheRS, PheT 0.0000103
Further Details:      
 
Domain Number 2 Region: 42-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.67e-42
Family Myf domain 0.0034
Further Details:      
 
Domain Number 3 Region: 481-696
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.14e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00044
Further Details:      
 
Domain Number 4 Region: 705-803
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.67e-30
Family Anticodon-binding domain of PheRS 0.0013
Further Details:      
 
Domain Number 5 Region: 417-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.51e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|344204702|ref|YP_004789845.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase subunit beta [Muricauda ruestringensis DSM 13258]
Sequence
MKISYNWLKQFLQIDWDAQKTGELLTDLGLEVEGISQFESVKGGLKGIVVGHVLTCEKHP
NADRLKLTTVDVGQEAPLQIVCGAPNVAAGQKVPVATVGTTLYTKEGEAWAIKKGKIRGE
VSQGMICAEDEIGLGESHDGIMVLNAELVPGTPCSKVFEIENDEVFEIGLTPNRSDAMSH
FGVARDLKAGLEQKEIQKELVTPSVSNFSIDNRSLKVDVEVLESDLAPRYCGVTISNLVV
QDSPDWLKNRLKAIGLAPINNIVDVTNYVLHELGQPLHAFDASKIKGNKVEVKTLPSGTK
FTTLDEVERELHEDDLMICDAGSPMCIAGVFGGLHSGVTEHTTSIFLESAYFDPVSIRKT
AKRHGLNTDASFRFERGIDIEMTKYALKRAALLIREIAGGYITSEIADLFPKKPQERQVF
LTFNKINSLIGQEIPQDTIKSILSALEIRINNVTESGLGLTIPTYRVDVTREVDVIEEIL
RVYGYNNIDFKEKLNASIAKSSRFENYRIQDVIGDTLAAKGFFEIMTNSLVSSDIASEDE
SAVQMLNPLSSDLSVLRTSMLHSGLQTVSYNHNRQKTDLKLFEFGKTYHKVGGNHQEKQH
LAIFISGERTQSSWAVASRRSEFFYLKGIVENVFERLGIRDIDTKPLTDSDFAEGVSYVK
NDKVLVSLGLVGKTALKRFDIKQEVFYADLDWDAILECVSTQNIAFKEIPKFPEVTRDFA
LLLDDSVSFQKVYDIAWNTEKKLLKKVNLFDVYTGKNLPEGKKSYAVSFTLMDDKKTLTD
KQIEKIMGKLLSQYQKELGAELR
Download sequence
Identical sequences G2PNL0
gi|344204702|ref|YP_004789845.1| WP_014034697.1.32214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]