SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344201500|ref|YP_004786643.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344201500|ref|YP_004786643.1|
Domain Number 1 Region: 42-314
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.49e-39
Family Alanine racemase-like, N-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 283-440
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-20
Family Eukaryotic ODC-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|344201500|ref|YP_004786643.1|
Sequence length 484
Comment Orn/DAP/Arg decarboxylase 2, N-terminal, partial [Muricauda ruestringensis DSM 13258]
Sequence
MKTKYIDLIEQTYDFPQEEFQLEDNKLQFHGIDLYGLVQRYGTPLKFTYLPKISENIQRA
KGWFNKAIKNHNYPGKYHYCYCTKSSHFEHVLNEALKNDIHIETSSAFDINIVEHLKNAG
KITKDTYVICNGFKRDQYIQNIAKLINEGHRNCIPIIDNYEEINLLGEVIDGKFQIGIRI
ASEEEPKFEFYTSRLGIGYKNIVPFFNQSIKPNKQVELKMLHFFINTGIRDTAYYWNELL
KCLKVYINLKKVCPTLDGLNIGGGFPIKNSLAFEYDYEYMVDEIIHQIAQACEEADVEPP
NIFTEFGSFTVGESGGNIYEVLYQKQQNDREKWNMINSSFITTMPDSWAISKRFIMLAIN
RWNDEYERILLGGLTCDSDDYYNSEQHMNAIYLPKYRKDKPLYIGFFNTGAYQETIGGFG
GLQHCLIPSPKHILINKDEEGNIKTSVFAEQQTAGEFLSILGYGNKKSADVMVKANDLSV
SSKN
Download sequence
Identical sequences G2PSG2
WP_014031505.1.32214 gi|344201500|ref|YP_004786643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]