SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA03G33240.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G33240.1
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000188
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G33240.1
Sequence length 165
Comment pep:novel chromosome:AWHD00000000:3:28476790:28487649:1 gene:ONIVA03G33240 transcript:ONIVA03G33240.1 description:""
Sequence
MYMTAGWAQFIEATGLQVQEPAVFRVLSTSKMHFIIFAKDGYLRCPVPDKPRDSEPTRQS
FRTSSPQGKATTITSPIQCCIKGKLKHDGTSTSASNNRRTISEMCFCTKDIRLSAEVKDY
IKDIAPFLQPSDKFYVTAINATFMKEGRVYLAKEFSKKYIAPLAR
Download sequence
Identical sequences A0A0E0GST0
ONIVA03G33240.1 ONIVA03G33240.2 ONIVA03G33240.3 ONIVA03G33240.4 ONIVA03G33240.7 ONIVA03G33240.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]