SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA01G49860.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA01G49860.1
Domain Number 1 Region: 280-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 9-53,95-180
Classification Level Classification E-value
Superfamily POZ domain 2.04e-17
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA01G49860.1
Sequence length 506
Comment pep:novel chromosome:AWHD00000000:1:41278154:41280897:-1 gene:ONIVA01G49860 transcript:ONIVA01G49860.1 description:""
Sequence
MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCCAAADQA
AAPPGALLLDHLSPRSPSGGASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQ
FLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQL
AGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDEL
RLKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVM
GEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVA
VLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMV
MSREDAQTAAVNAAPIYGESPGGGGGGGVYNASGTSSSMVNLSLDNRMVYLNLGMDAQFG
KMNDGGDGDDGGSRGPSSLFSPHGFP
Download sequence
Identical sequences A0A0E0FYS4
ONIVA01G49860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]