SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA03G27260.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G27260.1
Domain Number 1 Region: 1267-1365
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-23
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 22-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 735-833
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-19
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 202-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-18
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 5 Region: 935-1040
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-17
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 6 Region: 400-495
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 7 Region: 1152-1242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-16
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 8 Region: 1489-1594
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000654
Family B3 DNA binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G27260.1
Sequence length 1601
Comment pep:novel chromosome:AWHD00000000:3:22843097:22860700:1 gene:ONIVA03G27260 transcript:ONIVA03G27260.1 description:""
Sequence
MAGSGSCMKKSCVCCQKYLEHLDGKMNCFVRRMTADSRRSMIMPCKFVNHFGGDFSGTIK
LQSPNGILYAVEVTKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRFEVLIFDSDD
CEKNHQRVKDLPEIKREASAIVEKQQTWHLLLRIQAREDSPSEHESVESGDLETSQEPYV
LSRRSYLSEFQKEKVDALIQEIQPETTAFVAIMRKSNVQLPTPFLVISFCYAEVHFPHKS
VTVTLQRPCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDARRNF
TFTVHLLRVAAAYSRGGTGVDRAGSSLGRTDVKSASEISIKEEPIDQEENVSSRNRYGVS
DESEEDEDSEGPAHPPYIVPCKSRLSRLQKKIVEEKVRSIQSKFPVYVAIMKKSNVERSA
SRCQLELGARFAAAVHLPDRRQTVVLQRRGERWATVMQIRSGTRRLLISGWHRFVRDNRL
RVGDICLFEFKTHERWRLTMAVHAIFREHSRVALPRGGSGGDDPAAPLPHPYPLLRSASP
SPERPPAKPRGHKDGSGGVLLVSSRSGGLGSRPEWRRRCLPDPRRSGRIWRDGLAARTGD
GGGRGELRGVVLWVMAAGMATVLGWRWWRPRIRRWRTRIRRRRTRIRRRRGGQRWPEHAS
TPRLPLASSGAPLDIGRRWWRGRRPDLAPCPDPARPRVGTGWLESGRRAGGVNIAGNTHR
KKSCACCKEYLEHLGGKMRCFLRRMAADSMHSMIMPDRFVSHFGGKIPGTIKLESPNGIL
YVVEVTECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRYEVLILDSDDCEKVFSCA
GIRNGSCVQDKTVDPVDSSGSSSNDTTQSSRSRNTENLTAMCSSSEKSGEDSPSGYEFHE
SVEPQTPSGSDYVLSRRTYLSEAQKERVVAHIQDIQPEITVFVAVMKKCNLQSPAPYLVI
SSRYASVHFPRETATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWQNFVHDNCLQEEDI
CLFVPTKGGRNFAFTVHLLQAEATHSRDGTDVHKIGSSQNKRNSKMASQVHIKEAPGGDV
SSESNKHGVSHESLESEDSDGPSEPPYISSMRRRLSQLQKKTVEEKVRAIQSEIPICVAT
ISKLAGSGGKGKFRGLELSSRYAASYLPDKNHQTLVLQCKGMIWQINLVVRRRYTKGKRW
FLTAGWRKFAHDNRLRVGDFCLFELKKKKKLTMEVHIISNLQLHMAGGGSRMKKSCACCK
RYLEHLGGKMSCFLIRMTTDSMHSMIIPDRFVNHFGGKIPGTIKLESPNGILYVVEVTEC
MNKTVLQCGWEAFVDAHHIKVGDSLLFRHIENSCFEVMILDSDGCERVFSCAGIKTSSCV
HDKTVDPVDTSGRSSDDTAQPSRSERFVRCQRDTSNDRRNTASLTVVSSSSEESENVSLK
SNRNGVSDESQESEDSEGPAGPPYILSWKSKRRLSSLQKKIIKEKVRSIQSEVPIYVAIM
NKSNIGLISSPCQLELGARYAAAVHLPDRRQAVVLQRMGQRWDTVMQTKSGRCTTRRFLI
NGWSRFVRDNRLCVGDICLLELKKHESKLTMTVHTIFSQQS
Download sequence
Identical sequences A0A0E0GQK2
ONIVA03G27260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]