SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA03G27270.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G27270.1
Domain Number 1 Region: 314-407
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-23
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 2 Region: 601-701
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-21
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 97-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-20
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1023-1131
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-19
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 5 Region: 814-915
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.61e-18
Family B3 DNA binding domain 0.0085
Further Details:      
 
Domain Number 6 Region: 481-574
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-17
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G27270.1
Sequence length 1134
Comment pep:novel chromosome:AWHD00000000:3:22873095:22888711:1 gene:ONIVA03G27270 transcript:ONIVA03G27270.1 description:""
Sequence
MAQGPTYSPVFPFLLTSFFFPSYCHSPGRRWRRSGRQRAGEAVGGGRSYLAAQEGAETGL
NELARPRGRFTCMAGQGSQKKKSCDWSKRYVDHLNGKMKCFHLQMSANFGHSMTIPNKFL
DHFGGTLSRTIELVSPKGIVYIVKVTEHMNKTILQCGWEAFVDAHHIEENDSLLFRHIEN
SRFEVLILDSDGCEKVFTCAGIKKTSSVQERNAAPVDISRSTHDETTQSSGSKKIVRCQR
ASDSQRGKTAKLAETSSSGESGEEGTDSSTSEDESSYELDDPQMPPGRNYVLSRWTSLSE
AQEEKVDMLVQDIQPEIPVFVAIMKHSNVNSRRACLVIPKRYASAHFPLESQTITLQRQG
KNKKWYPMFYIRKDGSGYMLYGCWKKFVRDNHVKEGDMCIFHLTKFTGGEFGATVHLLRE
TKSGSLGSFHTSHKRFDLRDGRTWPKVTGVRRVSSRPYLTADRVSLTEEQVRKVEEVVHS
IQSEGPMYVSIMNKSNVGTDGLYIIIFGRQFATRYLPEGEQTLTLLMTGKSAWQVKMRPR
SGDAKMITTGWRHFVHDNHLQIEDICLFQLMNDEIHMAGQGSQMKKYCDCCKRYVDHSNG
KMKCFHRQMSANFEHSMIIPNKFLNQFGGKISRTVELESPKGNVYVVKVSKHMNKAVLQC
GWEAFVDAHQIEENDSLLFRHIENSRFAVLILDSDGCEKVFSCSGKRRASGVQQRNADPI
DVSSSTHDDTAQSSGGERFARSESGSETAKLAATCSSGGSGEEAKESSSSEHESSYDLVD
PQIAPMPGYVLSRGTNLSQAHEEKLDMLVQEIRPEIPLYVTTMKHSNVNSHHASLVIAKH
YACAYFPHTSQTITLKWHGKNRKWHPKFYIRKDQVGYILHGRWIDFVCHNHVKEGDICIF
HLKNFNGRKFRATVHLLRETIPHSFGALHIPKRFESRNGRMRLKMTDDRRVSSTECRRGT
MEPSTTNVKKEADNEQCNNGQGKRQEPLNFDVSVGSSKPYLTADRVSLTEEQFMKVEENV
HSIQSEGPIYVSIMNKSNVGTDGLYIITLGRQFATRYLPEGEQTLTLLTTGTGKAWQVKM
RPRSGDARMFTLGWRDFVRDNLLQTEDICLFQLMKNSERGLAMKVHIIRHNERS
Download sequence
Identical sequences A0A0E0GQK3
ONIVA03G27270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]