SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA03G29830.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G29830.1
Domain Number 1 Region: 266-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-16
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 65-187
Classification Level Classification E-value
Superfamily POZ domain 0.0000000345
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G29830.1
Sequence length 591
Comment pep:novel chromosome:AWHD00000000:3:25508005:25510573:-1 gene:ONIVA03G29830 transcript:ONIVA03G29830.1 description:""
Sequence
METSTISFSSSSPPSPPPPQPAPGDIDAVSLGRLSRNLENLLDPAFLNCADAEIVLASGG
GDPGGGAVVGVHRCILAARSRFFYDHFSSAPAPAPAPATAGDKPQLDLDGLVPGGRHIGR
DALVAVLSYLYTGRLRSAPPEAAACLDDGCSHDACRPAIDFVVESTYAASGFQISELVSL
FQRRLSDFVNKALAEDILPILVVASTCHLPELLNQCIQRVANSNLDNRYLEKRLPDDLYA
KLKEFRVPDEPHSGILDPEHEKRVRNIHKALDSDDVDLVGMLLKESPVTLDDAFAIHYAA
AYCEPKVLAELLKLESANVNLKNSSGYTPLHMACMRREPDIIVSLIEKGASVLERTQDGR
DALTICKRLTREKDRNEKSEKCKERSKAYLCIGVLQQEIKRRPQILEDQMSAEESIATPL
LVDNFHMRLLNLENRVAFARIFFPSEAKLVMRIAQADSTQEFAGLTSANFSKLKEVDLNE
TPTMQNRRLRERLDALTKTVELGRRYFPHCSEVLDKFLNEESTDLILLESGTAEDQQTKR
MRFSELREDVRKAFTKDKAAGAAISSSTSASSSPRYETKLRPGNKKGKLSR
Download sequence
Identical sequences A0A0E0GRH3
ONIVA03G29830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]