SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA04G19520.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA04G19520.1
Domain Number 1 Region: 2027-2313
Classification Level Classification E-value
Superfamily BEACH domain 7.72e-126
Family BEACH domain 0.00000000975
Further Details:      
 
Domain Number 2 Region: 2435-2504,2539-2654,2693-2740
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.66e-30
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 3 Region: 1912-2012
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000178
Family PreBEACH PH-like domain 0.0027
Further Details:      
 
Domain Number 4 Region: 279-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000882
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA04G19520.1
Sequence length 2766
Comment pep:novel chromosome:AWHD00000000:4:20471381:20490944:-1 gene:ONIVA04G19520 transcript:ONIVA04G19520.1 description:""
Sequence
MAEEPRESLDSSPEPPPPGQDSDEQFSAVPLADEVRAEGSELDPDTSAGTSVAVTPARSE
PSPPPPRRRRPRPLGVPPDAPQEVVRAVDDAIMVGGGAAAAAGVDRLHEMVSEEQGELPH
TVVDVLLGTMGGADGLDEVEDKTGTGAPPSIMFNSRAAVVAAELLPYLPCGDEPSPRTRM
AVGIHATLRACTRNRAMCSSSGLLPVLLDSAEKLLIGMGRASSWDGTPLLHCIQLLGGHS
LSVKDLHSWLGLVKKALGTSWATPLMLALEKAMGSEEARGPAATFEFDGESSGLLGPDNQ
GVEAYFHGQFLVVESGGGRGKKASLHFTYAFKPQRWYFVGLEHTNKHGLLGKGDSELRLY
VDGSLHESRPFEFPRISKPLAFCCIGTNPPPTIAGLQRRRRQCPLFAEMGPIYIFREPIG
PERMGRLASRGGDVLPSFGNGAGLPWRATNDHVKNMAEESFTLNQQIGGCLHLLYHPSLL
NGRLCPDASPSGSAGTHRRPAEVLGLVHVSSRVRPAESLWALAYGGPMALLPLTISNVQM
DSLEPMLGELSIATASLSAPIFRIISLAIQHPGNNEELCRTCSPEILSRVLHYQLQAFPK
MEGGEGEAVTDEELVDAIVSLCQSQRNNHELKVQLFSTLLLDLKMWSSCTYGLQKKLLSS
LADMIFTEAACMRDANALQMLLDSCRRCYWAIREPNSIDNFALTGTKRSLGEINALIDEL
LVVVELLLGSASSTAASDDVRCLIGFVVDCPQPNQVARVLHLIYRLIVQPNISRANMFAQ
SFISCGGVDALLVLLQREAKAGNNSILDNSDALLSENDFLRNDDSDTKAASGEAKSQDDQ
IQSVELEQHESILHEEHTELGSTSTNDVPCEILGSSIGRKLSSSENQLLKNLGGINFSIT
ADNVRNNVYNVDKGDGIVVGIIHILGALVASGHLKFASRAANPNLPGGLLTTVHEEGNTM
SEDRVSLLLFALQKAFQAAPRRLMTVNVYMALISAAINVSSVDENLNLYDCGHRFEHIQL
LLVLLRSLPYASRSFQSRAIQDLLFLACSHPENRTTMTSISEWPEWILEVLIYNHEDVEA
TIHCAEWLSMVGGSSTGDQRIRREESLPILKRRLLGGLLDFSARELQVQTEVIAAAAAGV
AAEGLSPEEAKTQAENAAHLSVALAENAIVILMLVEDHLRSQGQHFCTSRSLDSAVPSAS
MVSSAASRSNSLCRSGNEPMDAGTSRRSSLSTDAGGLPLDVLTSMADSNGQISAAVMERL
TSAAAAEPYESVKHAFVSYGSCIADLAESWKYRSRLWYGVGIPSKSDTFGGGGSGWEFWK
SVLEKDSNGTWVDLPLVKKSVAVLQALLLDDSGLGGGLGIGGGSGPGMGVMTALYQLLDS
DQPFLCMLRMTLVSMREDDNGEGDAFTGNISIKDVISEGLGHQAGSMMPLDSNNRSSTRK
PRSALLWSVLGPILNMPINESKRQRVLVASSILYSEVWHAIGRDRSPLRKQYIELILPPF
IAILRRWRPLLAGIHELTSSDGQNPLISDDRALAADALPIEAALSMISPGWAAAFASPPV
ALALAMMAAGASGTEAIAPPRTLNRRDTSVPERKAAPKLQSFTSFQKPIETAPNKHGSTP
KDKAAVKAAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSAGDIERAKRWNTSEAMSA
AWMECLQSVDSKSVSGRDFSALSYKYVAILVSGFALARNLQRVEMERQTQADVLNRHRVS
TGVRAWRHLLHCLTEMDRLYGPFGEPLCAPDRIFWKLDFTESSSRMRRFMKRNHKGSDHL
GAAADYEERKLSNVAQSNECNPEGTEPLVTDTLPSTAPIITAEAMSVDDRNEDNEQLESD
TTQSSVDDRLQQADQQSVKGSIDSRGSGISADRNLVRSTVIAPGYVPSDADERIIVELPS
SMVRPLKVVRGTFQVTSKRINFIIDESASESNMDDHASTSGQCDQQDKDRSWLISSLHQI
YSRRYLLRRSALELFMDMEARKNAYRAIVHSKPPNLNDIFLATQRAEQILKRTQLTERWA
NWEISNFEYLMELNTLAGRSYNDITQYPVFPWIIADYRSEILNLDDPCTYRDLSKPIGAL
NPERLEKFQERYSTFEDPIIPKFHYGSHYSSAGTVLYYLFRVEPYTTLSIQLQGGKFDHA
DRMFSDLSGTWDSVLEDMSDVKELVPEMFYLPEVFTNINSIDFGTTQLGGKLDSVNLPPW
AEDPVDFVHKHRKALESEHVSAHLHEWIDLIFGFKQRGKEAVMANNVFFYITYEGTVDID
KITDPVQRQAMQDQIAYFGQTPSQLLTIPHMKRKPLAEVLHLQTIFRNPSELKSYLLPNP
DRCNVPASTMFVSNDSIVVVDVNVPAAHVALHHWQPNTPDGQGTPFLFHHGRNAANSTGG
ALMRIFKGSASSGEDYDFPRAIAFAASSIRSSAVVAVTCDKEIITGGHADGSVKLISPDG
AKTIETATGHLAPVTCLALSHDSNYLVTGSRDTTVILWRIHQAGSLHKKNAPEPPPTTPT
TPRSPSVSNLTEIRRRRIEGPMHVLRGHLEEVTSCSVSPDLGLVVSSSNMSGVLLHSLRT
GRLIRKLNVAEAHAVCLSSQGVILVWNESKKRLSTFTVNGLPIATTVLSPFCGRVSCIEI
STDGHFALMGTCSSSNYKCEDSTETGDHEPNEPNGKDGISKQAETRQSVHVPSVCFVDLH
KLKVFHTMELGKGQDVTAIALNKENTNLLLSTADKQLIVFTDPALSLKVVDQMLRLGWEG
DGLLQS
Download sequence
Identical sequences A0A0E0H426
ONIVA04G19520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]